CacheBy
Atlas Antibodies Anti-RTCA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTCA Antibody

상품 한눈에 보기

Human RTCA 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체이며, 고순도의 Affinity Purified 제품. Human, Mouse, Rat 종에 반응성을 검증함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA027990-100 Anti-RTCA Antibody, RNA 3`-terminal phosphate cyclase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027990-25 Anti-RTCA Antibody, RNA 3`-terminal phosphate cyclase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTCA Antibody

Anti-RTCA Antibody

Target: RNA 3'-terminal phosphate cyclase


  • Immunohistochemistry (IHC)
  • Western Blot (WB, Independent validation)
    • Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human RTCA.


Alternative Gene Names

RPC, RTC1, RTCD1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein RNA 3'-terminal phosphate cyclase
Target Gene RTCA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LFAASPSELHLKGGTNAEMAPQIDYTVMVFKPIVEKFGFIFNCDIKTRGYYPKGGGEVIVRMSPVKQLNPINLTERGCVTKIY

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000014575 (90%)
  • Mouse ENSMUSG00000000339 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Independent
Independent Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.