CacheBy
Atlas Antibodies Anti-RSPRY1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSPRY1 Antibody

상품 한눈에 보기

인간 RSPRY1 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC에 적합하며, 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간, 생쥐, 랫트 간 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA003729-100 Anti-RSPRY1 Antibody, ring finger and SPRY domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003729-25 Anti-RSPRY1 Antibody, ring finger and SPRY domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSPRY1 Antibody

Anti-RSPRY1 Antibody

Target: ring finger and SPRY domain containing 1 (RSPRY1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Validation: Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human RSPRY1 (ring finger and SPRY domain containing 1).

Alternative Gene Names

  • KIAA1972

Open Datasheet

Target Information

항목 내용
Target Protein ring finger and SPRY domain containing 1
Target Gene RSPRY1
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000060931 (99%), Mouse ENSMUSG00000050079 (99%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEILNLNGEVACQDSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQC

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.