CacheBy
Atlas Antibodies Anti-RSPRY1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSPRY1 Antibody

상품 한눈에 보기

인간 RSPRY1 단백질을 인식하는 토끼 폴리클로날 항체. WB 및 IHC에 적합하며, 재조합 발현 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인간, 생쥐, 랫트 간 높은 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA003729-100 Anti-RSPRY1 Antibody, ring finger and SPRY domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA003729-25 Anti-RSPRY1 Antibody, ring finger and SPRY domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSPRY1 Antibody

Anti-RSPRY1 Antibody

Target: ring finger and SPRY domain containing 1 (RSPRY1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression)

Validation: Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against human RSPRY1 (ring finger and SPRY domain containing 1).

Alternative Gene Names

  • KIAA1972

Open Datasheet

Target Information

항목 내용
Target Protein ring finger and SPRY domain containing 1
Target Gene RSPRY1
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000060931 (99%), Mouse ENSMUSG00000050079 (99%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GRGPHEPRRKKQNVDGLVLDTLAVIRTLVDNDQEPPYSMITLHEMAETDEGWLDVVQSLIRVIPLEDPLGPAVITLLLDECPLPTKDALQKLTEILNLNGEVACQDSSHPAKHRNTSAVLGCLAEKLAGPASIGLLSPGILEYLLQC

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.