
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RSPH4A Antibody
상품 한눈에 보기
Human RSPH4A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. RNA-seq 데이터 기반 Orthogonal Validation을 거쳤으며, PrEST 항원을 이용해 Affinity 정제되었습니다. Human에 특이적으로 반응하며, 연구용으로 권장됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031198-100 Anti-RSPH4A Antibody, radial spoke head 4 homolog A (Chlamydomonas) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031198-25 Anti-RSPH4A Antibody, radial spoke head 4 homolog A (Chlamydomonas) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RSPH4A Antibody
Anti-RSPH4A Antibody
radial spoke head 4 homolog A (Chlamydomonas)
Recommended Applications
- IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human RSPH4A
Alternative Gene Names
CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | radial spoke head 4 homolog A (Chlamydomonas) |
| Target Gene | RSPH4A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000039552 (41%), Rat ENSRNOG00000058561 (37%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



