CacheBy
Atlas Antibodies Anti-RSPH4A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSPH4A Antibody

상품 한눈에 보기

Human RSPH4A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. RNA-seq 데이터 기반 Orthogonal Validation을 거쳤으며, PrEST 항원을 이용해 Affinity 정제되었습니다. Human에 특이적으로 반응하며, 연구용으로 권장됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031198-100 Anti-RSPH4A Antibody, radial spoke head 4 homolog A (Chlamydomonas) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031198-25 Anti-RSPH4A Antibody, radial spoke head 4 homolog A (Chlamydomonas) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSPH4A Antibody

Anti-RSPH4A Antibody

radial spoke head 4 homolog A (Chlamydomonas)

  • IHC (Immunohistochemistry)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human RSPH4A

Alternative Gene Names

CILD11, dJ412I7.1, FLJ37974, RSHL3, RSPH6B

Open Datasheet

Target Information

항목 내용
Target Protein radial spoke head 4 homolog A (Chlamydomonas)
Target Gene RSPH4A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RPWEGKTAASPQYSEPESSEPLEAKQGPETGRQSRSSRPWSPQSRAKTPLGGPAGPETSSPAPVSPREPSSSP
Verified Species Reactivity Human
Interspecies Homology Mouse ENSMUSG00000039552 (41%), Rat ENSRNOG00000058561 (37%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.