CacheBy
Atlas Antibodies Anti-RSPH14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RSPH14 Antibody

상품 한눈에 보기

인간 RSPH14 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB 응용에 적합하며 PrEST 항원으로 친화 정제됨. 인간에 대해 검증되었으며, 랫드 및 마우스와 유사성 있음. 안정한 PBS-글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA018420-100 Anti-RSPH14 Antibody, radial spoke head 14 homolog (Chlamydomonas) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018420-25 Anti-RSPH14 Antibody, radial spoke head 14 homolog (Chlamydomonas) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RSPH14 Antibody

Anti-RSPH14 Antibody

Target: radial spoke head 14 homolog (Chlamydomonas)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human RSPH14.


Alternative Gene Names

  • RTDR1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein radial spoke head 14 homolog (Chlamydomonas)
Target Gene RSPH14
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000001315 69%
Mouse ENSMUSG00000009070 65%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.