CacheBy
Atlas Antibodies Anti-RRS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RRS1 Antibody

상품 한눈에 보기

인체 RRS1 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. 고순도 PrEST 항원으로 친화 정제되었으며 인간, 생쥐, 랫트에 반응합니다. RNA-seq 기반 Orthogonal 검증으로 신뢰성 높은 단백질 발현 확인이 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055549-100 Anti-RRS1 Antibody, RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055549-25 Anti-RRS1 Antibody, RRS1 ribosome biogenesis regulator homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RRS1 Antibody

Anti-RRS1 Antibody

RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Orthogonal validation using RNA-seq comparison
  • Immunocytochemistry (ICC)

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human RRS1


Alternative Gene Names

  • KIAA0112

Open Datasheet


Target Information

항목 내용
Target Protein RRS1 ribosome biogenesis regulator homolog (S. cerevisiae)
Target Gene RRS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007240 (99%), Mouse ENSMUSG00000061024 (99%)

Antigen Sequence:

LHPTGHQSKEELGRAMQVAKVSTASVGRFQERLPKEKVPRGSGKKRKFQPLFGDFAAEKKNQLELLRVMNSKKP

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Orthogonal
Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.