CacheBy
Atlas Antibodies Anti-RRM2B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RRM2B Antibody

상품 한눈에 보기

Human RRM2B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존. p53R2로도 알려진 RRM2B 단백질 연구용.

카탈로그번호
HPA028812-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028812-100 Anti-RRM2B Antibody, ribonucleotide reductase M2 B (TP53 inducible) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028812-25 Anti-RRM2B Antibody, ribonucleotide reductase M2 B (TP53 inducible) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RRM2B Antibody

Anti-RRM2B Antibody

ribonucleotide reductase M2 B (TP53 inducible)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RRM2B.

Alternative Gene Names

  • p53R2

Open Datasheet

Target Information

항목 내용
Target Protein ribonucleotide reductase M2 B (TP53 inducible)
Target Gene RRM2B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence MGDPERPEAAGLDQDERSSSDTNESEIKSNEEPLLRKSSRRFV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022292 (67%), Rat ENSRNOG00000025454 (67%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.