CacheBy
Atlas Antibodies Anti-RPTN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPTN Antibody

상품 한눈에 보기

Human RPTN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 오쏘고날 검증에 적합. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성을 제공. RNA-seq 데이터 기반 단백질 발현 비교 검증에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030485-100 Anti-RPTN Antibody, repetin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030485-25 Anti-RPTN Antibody, repetin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPTN Antibody

Anti-RPTN Antibody

Target Protein: Repetin (RPTN)

Validated Application: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human RPTN.


Alternative Gene Names

  • FLJ39117

Open Datasheet (PDF)


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

ETVETILNLLDQDRDGHIDFHEYLLLVFQLVQACYHKLDNKSHGGRTSQQERGQEGAQDCKFPGNTGRQHRQRHEEERQNSHHSQ

Species Reactivity

  • Verified Reactivity: Human
  • Interspecies Identity:
    • Rat ENSRNOG00000018679 (71%)
    • Mouse ENSMUSG00000041984 (70%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative [MSDS]

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.