원본

Atlas Antibodies Anti-RPS2 Antibody

상품 한눈에 보기

Human RPS2 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055133-100 Anti-RPS2 Antibody, ribosomal protein S2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055133-25 Anti-RPS2 Antibody, ribosomal protein S2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RPS2 Antibody

Anti-RPS2 Antibody

Target Information

Target Protein: Ribosomal protein S2
Target Gene: RPS2
Alternative Gene Names: LLREP3, S2

Product Description

Polyclonal antibody against human RPS2 produced in rabbit. Suitable for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Antigen Sequence:

GCTATLGNFAKATFDAISKTYSYLTPDLWKETVFTKSPYQEFTDHLVKTHTRVSVQ

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000030174 (100%)
Mouse ENSMUSG00000044533 (100%)

Technical Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand