Atlas Antibodies Anti-RPS15 Antibody

상품 한눈에 보기

인간 RPS15 단백질을 표적으로 하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 항체 비교를 통한 검증 완료. 고순도 Affinity 정제 및 안정적인 PBS/glycerol buffer 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057793-100 Anti-RPS15 Antibody, ribosomal protein S15 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057793-25 Anti-RPS15 Antibody, ribosomal protein S15 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Ribosomal protein S15
Supplier: Atlas Antibodies

IHC (Independent validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against human RPS15.

MGC111130, RIG, S15

항목	내용
Target Protein	Ribosomal protein S15
Target Gene	RPS15
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000063457 (100%), Rat ENSRNOG00000024603 (100%)

Antigen Sequence:
MAEVEQKKKRTFRKFTYRGVDLDQLLDMSYEQLMQLYSARQRRRLNRGLRRKQH

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand