CacheBy
Atlas Antibodies Anti-RPS10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPS10 Antibody

상품 한눈에 보기

Human RPS10 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB에 적합합니다. 높은 종간 반응성(마우스·랫 98%)을 가지며 PrEST 항원으로 정제되었습니다. PBS/glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047268-100 Anti-RPS10 Antibody, ribosomal protein S10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047268-25 Anti-RPS10 Antibody, ribosomal protein S10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPS10 Antibody

Anti-RPS10 Antibody

Target: Ribosomal protein S10
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human RPS10.


Alternative Gene Names

MGC88819, S10

Open Datasheet


Target Information

항목 내용
Target Protein Ribosomal protein S10
Target Gene RPS10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000052146 (98%), Rat ENSRNOG00000000490 (98%)

Antigen Sequence:
GVMVAKKDVHMPKHPELADKNVPNLHVMKAMQSLKSRGCVKEQF


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.