
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RPL8 Antibody
상품 한눈에 보기
Human RPL8 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. siRNA 노크다운 및 독립 항체 비교를 통한 신뢰성 높은 검증. PrEST 항원으로 친화 정제되어 높은 특이도와 재현성 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA045095-100 Anti-RPL8 Antibody, ribosomal protein L8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045095-25 Anti-RPL8 Antibody, ribosomal protein L8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RPL8 Antibody
Anti-RPL8 Antibody
Target: Ribosomal protein L8
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent Antibody Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic Validation): Genetic validation in western blot by siRNA knockdown.
Product Description
Polyclonal antibody against human RPL8.
Alternative Gene Names
- L8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Ribosomal protein L8 |
| Target Gene | RPL8 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | LAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000048523 (100%), Mouse ENSMUSG00000003970 (100%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 항목 | 내용 |
|---|---|
| Buffer Composition | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



