
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RPL21 Antibody
상품 한눈에 보기
Human RPL21 단백질을 인식하는 폴리클로날 항체입니다. 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. 토끼 숙주에서 생산된 IgG 형 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 인간, 랫, 마우스에 모두 반응합니다.
- 카탈로그번호
- HPA047252-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA047252-100 Anti-RPL21 Antibody, ribosomal protein L21 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047252-25 Anti-RPL21 Antibody, ribosomal protein L21 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RPL21 Antibody
Anti-RPL21 Antibody
Target Information
- Target Protein: Ribosomal protein L21
- Target Gene: RPL21
- Alternative Gene Names: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human RPL21.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000038458 (100%)
- Mouse ENSMUSG00000041453 (100%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet
- Open Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



