Atlas Antibodies Anti-RPL21 Antibody

상품 한눈에 보기

Human RPL21 단백질을 인식하는 폴리클로날 항체입니다. 면역조직화학(IHC) 및 면역세포화학(ICC)에 적합합니다. 토끼 숙주에서 생산된 IgG 형 항체로, PrEST 항원을 이용해 친화 정제되었습니다. 인간, 랫, 마우스에 모두 반응합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA047252-100 Anti-RPL21 Antibody, ribosomal protein L21 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA047252-25 Anti-RPL21 Antibody, ribosomal protein L21 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: Ribosomal protein L21
Target Gene: RPL21
Alternative Gene Names: DKFZp686C06101, FLJ27458, L21, MGC104274, MGC104275, MGC71252

Polyclonal antibody against human RPL21.

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence: RGTRYMFSRPFRKHGVVPLATYMRIYKKGD

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
Material Safety Data Sheet
Open Datasheet