CacheBy
Atlas Antibodies Anti-RPL13A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPL13A Antibody

상품 한눈에 보기

Human RPL13A 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합. PrEST 항원을 이용해 친화 정제되었으며 높은 종간 보존성 보유. 40% 글리세롤 기반 PBS 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038751-100 Anti-RPL13A Antibody, ribosomal protein L13a 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038751-25 Anti-RPL13A Antibody, ribosomal protein L13a 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPL13A Antibody

Anti-RPL13A Antibody

Target: ribosomal protein L13a
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human RPL13A.


Alternative Gene Names

L13A, TSTA1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ribosomal protein L13a
Target Gene RPL13A
Antigen Sequence AHEVGWKYQAVTATLEEKRKEKAKIHYRKKKQLMRLRKQAEKNV
Antigen Type Recombinant Protein Epitope Signature Tag (PrEST)

Species Reactivity

항목 내용
Verified Reactivity Human
Interspecies Identity Rat ENSRNOG00000020618 (98%)
Mouse ENSMUSG00000074129 (93%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.