Atlas Antibodies Anti-RPAP3 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA038312-100 | - | Atlas Antibodies HPA038312-100 Anti-RPAP3 Antibody, RNA polymerase II associated protein 3 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA038312-25 | - | Atlas Antibodies HPA038312-25 Anti-RPAP3 Antibody, RNA polymerase II associated protein 3 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-RPAP3 Antibody
RNA polymerase II associated protein 3
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human RPAP3
Alternative Gene Names
FLJ21908, spag
Target Protein
RNA polymerase II associated protein 3
Target Gene
RPAP3
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
SEKMPIEIEQKPAQFATTVLPPIPANSFQLESDFRQLKSSPDMLYQYLKQIEPSLYPKLFQKNLDPDVFNQIVKILHDFYIEKEKPLLIFEILQRLSELKRFDMAVMFM
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000022466 (79%)
Rat ENSRNOG00000053405 (78%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|