
원본
Atlas Antibodies Anti-DDIAS Antibody
상품 한눈에 보기
인간 DDIAS 단백질을 인식하는 폴리클로날 항체. DNA 손상 유도 세포사멸 억제 단백질 연구에 적합. 토끼 유래 IgG, PrEST 항원으로 친화 정제. 면역조직화학 등 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038540-100 Anti-DDIAS Antibody, DNA damage-induced apoptosis suppressor 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038540-25 Anti-DDIAS Antibody, DNA damage-induced apoptosis suppressor 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DDIAS Antibody
Anti-DDIAS Antibody
DNA damage-induced apoptosis suppressor
Recommended Applications
면역조직화학(IHC) 등 다양한 응용에 권장됩니다.
Product Description
Polyclonal antibody against human DDIAS.
Alternative Gene Names
C11orf82, FLJ25416, FLJ38838, noxin
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DNA damage-induced apoptosis suppressor |
| Target Gene | DDIAS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ILVSKRSNCPKCGSTGESGNANYRYKLSLKVAESNKLFVITVFGSCLDTFFGLTATGLHRYIQDPNKIPETLDNDTTQNLLTKAVETCFVGQSFIFGVTNFENQP |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000030641 (74%)
- Rat ENSRNOG00000022521 (74%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



