CacheBy
Atlas Antibodies Anti-DDB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDB2 Antibody

상품 한눈에 보기

인간 DDB2 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC 실험에 적합. 정제된 PrEST 항원 기반 친화 정제 제품. Rabbit IgG로 제작되었으며, RNA-seq 데이터와 비교한 단백질 발현 Orthogonal 검증 완료. PBS와 글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058406-100 Anti-DDB2 Antibody, damage-specific DNA binding protein 2, 48kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058406-25 Anti-DDB2 Antibody, damage-specific DNA binding protein 2, 48kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDB2 Antibody

Anti-DDB2 Antibody

Target Protein: damage-specific DNA binding protein 2, 48kDa
Supplier: Atlas Antibodies

  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human DDB2

Alternative Gene Names

DDBB, FLJ34321, UV-DDB2

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein damage-specific DNA binding protein 2, 48kDa
Target Gene DDB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (76%), Mouse (74%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Antigen Sequence:

GPSRRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTR

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Safety Information

Material Safety Data Sheet

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.