CacheBy
Atlas Antibodies Anti-DCPS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DCPS Antibody

상품 한눈에 보기

Human DCPS 단백질을 표적으로 하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 적합함. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039632-100 Anti-DCPS Antibody, decapping enzyme, scavenger 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039632-25 Anti-DCPS Antibody, decapping enzyme, scavenger 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DCPS Antibody

Anti-DCPS Antibody

Target: Decapping enzyme, scavenger (DCPS)
Type: Polyclonal Antibody against Human DCPS
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Genetic validation by siRNA knockdown)
  • ICC (Immunocytochemistry)

Alternative Gene Names

  • HINT-5
  • HSL1
  • HSPC015

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Decapping enzyme, scavenger
Target Gene DCPS
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence QLGKRKRELDVEEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRESARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVAQLLTGSPE
Verified Species Reactivity Human
Interspecies Homology Mouse (85%), Rat (82%)

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Genetic Validation
Genetic Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.