CacheBy
Atlas Antibodies Anti-DCTN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DCTN1 Antibody

상품 한눈에 보기

Human DCTN1 단백질을 인식하는 토끼 폴리클로날 항체로, WB, IHC, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 인간, 쥐, 랫드에서 100% 서열 동일성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA034635-100 Anti-DCTN1 Antibody, dynactin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA034635-25 Anti-DCTN1 Antibody, dynactin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DCTN1 Antibody

Anti-DCTN1 Antibody

Target Protein: dynactin 1
Target Gene: DCTN1

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human DCTN1, generated in rabbit.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

RELTNQQEASVERQQQPPPETFDFKIKFAETKAHAKAIEMELRQMEVAQANRHMSLLTAFMPDSFLRPGGDHDCVLVLLL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000010048): 100%
  • Mouse (ENSMUSG00000031865): 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.