CacheBy
Atlas Antibodies Anti-DCT Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DCT Antibody

상품 한눈에 보기

Human DCT 단백질을 인식하는 토끼 폴리클로날 항체로, dopachrome tautomerase 검출에 적합. 높은 특이성과 재현성을 제공하며, PrEST 항원으로 정제됨. 면역세포화학 등 다양한 응용에 추천.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010742-100 Anti-DCT Antibody, dopachrome tautomerase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010742-25 Anti-DCT Antibody, dopachrome tautomerase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DCT Antibody

Anti-DCT Antibody

Target Protein: dopachrome tautomerase
Alternative Gene Names: TYRP2

  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human DCT.

Target Information

항목 내용
Target Protein dopachrome tautomerase
Target Gene DCT
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022129 (88%)
Rat ENSRNOG00000029318 (52%)

Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):

NECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNALEGFDKADGTLDSQVMSLHNLVHSFLNGTNALPHSAANDPIFVVLHSFTDA

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.