Atlas Antibodies Anti-DCN Antibody
상품 한눈에 보기
Human DCN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 검증 완료. Recombinant expression 및 RNA-seq 기반 orthogonal validation 수행. Decorin 단백질 연구 및 조직 발현 분석에 적합. 고순도 affinity purification 방식으로 제조.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DCN Antibody
Target Protein: decorin
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal validation):
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Recombinant expression validation):
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody against Human DCN (decorin).
Alternative Gene Names
DSPG2, SLRR1B
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | decorin |
| Target Gene | DCN |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TNITSIPQGLPPSLTELHLDGNKISRVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLDNNKLTRVPGGLAEHKYIQVVYLHNNNISVVGSSDFCPPGHNTKKASYSGVSLFSNPVQY |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse (78%, ENSMUSG00000019929), Rat (76%, ENSRNOG00000004554) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.