
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DCAF11 Antibody
상품 한눈에 보기
Human DCAF11 단백질을 타겟으로 하는 고품질 폴리클로날 항체입니다. Rabbit에서 생산되었으며, IgG 아이소타입으로 다양한 연구 응용에 적합합니다. PrEST 항원으로 특이적 정제되어 높은 특이성과 재현성을 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031157-100 Anti-DCAF11 Antibody, DDB1 and CUL4 associated factor 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031157-25 Anti-DCAF11 Antibody, DDB1 and CUL4 associated factor 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DCAF11 Antibody
Anti-DCAF11 Antibody
DDB1 and CUL4 associated factor 11
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human DCAF11
Alternative Gene Names
- GL014
- PRO2389
- WDR23
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DDB1 and CUL4 associated factor 11 |
| Target Gene | DCAF11 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022214 (99%), Rat ENSRNOG00000018825 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
RKFKSIKARDVGWSVLDVAFTPDGNHFLYSSWSDYIHICNIYGEGDTHTALDLRPDERRFAVFSIAVSSDGREVLGGANDGCLYVFDREQNRRTLQIESHEDDVNAVAFADISSQILFSGGDDAICKVWDRRTMREDDPKP
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



