Atlas Antibodies Anti-DBT Antibody

상품 한눈에 보기

Human DBT 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에서 검증된 고품질 항체입니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 Rat, Mouse와 90% 서열 유사성을 가집니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026485-100 Anti-DBT Antibody, dihydrolipoamide branched chain transacylase E2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026485-25 Anti-DBT Antibody, dihydrolipoamide branched chain transacylase E2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: dihydrolipoamide branched chain transacylase E2 (DBT)
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in high and low expression tissues.
WB (Recombinant expression validation): Validation using target protein overexpression.

Polyclonal antibody against Human DBT.

항목	내용
Target Protein	dihydrolipoamide branched chain transacylase E2
Target Gene	DBT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGA
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000015029 (90%), Mouse ENSMUSG00000000340 (90%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)