
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DAZAP1 Antibody
상품 한눈에 보기
Human DAZAP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Orthogonal validation을 통해 단백질 발현 검증. 고순도 Affinity purified 제품으로 사람, 생쥐, 랫드 반응 확인됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA004631-100 Anti-DAZAP1 Antibody, DAZ associated protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA004631-25 Anti-DAZAP1 Antibody, DAZ associated protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DAZAP1 Antibody
Anti-DAZAP1 Antibody
DAZ associated protein 1
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 검증
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human DAZAP1
Alternative Gene Names
- MGC19907
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DAZ associated protein 1 |
| Target Gene | DAZAP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EPRDSKSQAPGQPGASQWGSRVVPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGFPQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPA |
Verified Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000069565 (98%)
- Rat ENSRNOG00000031387 (98%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 적합한 농도 및 조건은 사용자가 직접 최적화해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



