
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DARS Antibody
상품 한눈에 보기
Human DARS 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 Affinity 정제되었으며, 높은 종간 보존성과 신뢰성 있는 검증 데이터를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029804-100 Anti-DARS Antibody, aspartyl-tRNA synthetase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029804-25 Anti-DARS Antibody, aspartyl-tRNA synthetase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DARS Antibody
Anti-DARS Antibody
Target: Aspartyl-tRNA synthetase (DARS)
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- ICC
Product Description
Polyclonal Antibody against Human DARS
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Aspartyl-tRNA synthetase |
| Target Gene | DARS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICAD |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (97%), Rat (94%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도 및 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



