CacheBy
Atlas Antibodies Anti-DAPK3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DAPK3 Antibody

상품 한눈에 보기

Human DAPK3 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. ZIP, ZIPK로도 알려진 DAPK3를 타깃하며, PrEST 항원을 이용해 정제됨. 인체 반응성이 검증되어 연구용으로 신뢰성 높음.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064809-100 Anti-DAPK3 Antibody, death-associated protein kinase 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064809-25 Anti-DAPK3 Antibody, death-associated protein kinase 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DAPK3 Antibody

Anti-DAPK3 Antibody

Target: death-associated protein kinase 3 (DAPK3)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human DAPK3, also known as ZIP or ZIPK.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein death-associated protein kinase 3
Target Gene DAPK3
Alternative Gene Names ZIP, ZIPK
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLV

Species Reactivity

항목 내용
Verified Reactivity Human
Ortholog Identity Mouse ENSMUSG00000034974 (64%), Rat ENSRNOG00000020383 (63%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Information

항목 내용
Buffer Composition 40% glycerol, PBS (pH 7.2)
Preservative 0.02% sodium azide
Safety Data Sheet Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.