Atlas Antibodies Anti-CYP51A1 Antibody

상품 한눈에 보기

Human CYP51A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 검증 및 siRNA 기반 유전적 검증을 통해 신뢰성 확보. PrEST 항원을 이용한 친화 정제 제품입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA043508-100 Anti-CYP51A1 Antibody, cytochrome P450, family 51, subfamily A, polypeptide 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA043508-25 Anti-CYP51A1 Antibody, cytochrome P450, family 51, subfamily A, polypeptide 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cytochrome P450, family 51, subfamily A, polypeptide 1 (CYP51A1)
Supplier: Atlas Antibodies

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
ICC: Suitable for immunocytochemistry applications.

Polyclonal antibody against Human CYP51A1.

CP51, CYP51, CYPL1, LDM, P450-14DM, P450L1

항목	내용
Target Protein	cytochrome P450, family 51, subfamily A, polypeptide 1
Target Gene	CYP51A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	RSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQKRRQSQEKIDDILQTLLDATYKDGRPLTDDEVAGMLIGLLLAGQH
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000007234 (92%), Mouse ENSMUSG00000001467 (88%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand