CacheBy
Atlas Antibodies Anti-CYP2S1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYP2S1 Antibody

상품 한눈에 보기

Human CYP2S1 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포화학 등 다양한 연구 응용에 적합합니다. PrEST 항원을 사용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049227-100 Anti-CYP2S1 Antibody, cytochrome P450, family 2, subfamily S, polypeptide 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049227-25 Anti-CYP2S1 Antibody, cytochrome P450, family 2, subfamily S, polypeptide 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYP2S1 Antibody

Anti-CYP2S1 Antibody

Target: cytochrome P450, family 2, subfamily S, polypeptide 1 (CYP2S1)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CYP2S1.

Open Datasheet (PDF)


Target Information

  • Target Protein: cytochrome P450, family 2, subfamily S, polypeptide 1
  • Target Gene: CYP2S1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGMGKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000040703 (82%)
  • Rat ENSRNOG00000020743 (80%)

Additional Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.