CacheBy
Atlas Antibodies Anti-CYP27A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYP27A1 Antibody

상품 한눈에 보기

Human CYP27A1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation으로 검증되었으며, PrEST 항원으로 친화 정제되었습니다. PBS/glycerol buffer에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059155-100 Anti-CYP27A1 Antibody, cytochrome P450, family 27, subfamily A, polypeptide 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059155-25 Anti-CYP27A1 Antibody, cytochrome P450, family 27, subfamily A, polypeptide 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYP27A1 Antibody

Anti-CYP27A1 Antibody

Target: cytochrome P450, family 27, subfamily A, polypeptide 1 (CYP27A1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human CYP27A1.


Alternative Gene Names

CP27, CTX, CYP27


Target Information

항목 내용
Target Protein cytochrome P450, family 27, subfamily A, polypeptide 1
Target Gene CYP27A1
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000017188 (69%), Mouse ENSMUSG00000026170 (67%)

Antigen Information

Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

RQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLD

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Validation Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.