Atlas Antibodies Anti-CYP24A1 Antibody

상품 한눈에 보기

인체 CYP24A1 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 Orthogonal 검증 완료. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 반응성 확인 및 고품질 연구용 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA022261-100 Anti-CYP24A1 Antibody, cytochrome P450, family 24, subfamily A, polypeptide 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA022261-25 Anti-CYP24A1 Antibody, cytochrome P450, family 24, subfamily A, polypeptide 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CYP24A1 Antibody

Anti-CYP24A1 Antibody

Target: cytochrome P450, family 24, subfamily A, polypeptide 1
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human CYP24A1

Alternative Gene Names: CP24, CYP24, P450-CC24
Target Protein: cytochrome P450, family 24, subfamily A, polypeptide 1
Target Gene: CYP24A1
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQV

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038567 (91%)
Rat ENSRNOG00000013062 (90%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand