CacheBy
Atlas Antibodies Anti-CYP21A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYP21A2 Antibody

상품 한눈에 보기

인간 CYP21A2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 Western blot에 적합하며, RNA-seq 데이터 기반의 정교한 정합 검증 수행. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048979-100 Anti-CYP21A2 Antibody, cytochrome P450, family 21, subfamily A, polypeptide 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048979-25 Anti-CYP21A2 Antibody, cytochrome P450, family 21, subfamily A, polypeptide 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYP21A2 Antibody

Anti-CYP21A2 Antibody

Target: cytochrome P450, family 21, subfamily A, polypeptide 2
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal antibody against human CYP21A2.


Alternative Gene Names

CA21H, CAH1, CPS1, CYP21, CYP21B, P450c21B

Open Datasheet


Specifications

항목 내용
Target Protein cytochrome P450, family 21, subfamily A, polypeptide 2
Target Gene CYP21A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GLTQKFGPIYRLHLGLQDVVVLNSKRTIEEAMVKKWADFAGRPEPLTYKLVSRNYPDLSLGDYSLLW
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024365 (69%), Rat ENSRNOG00000000428 (67%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.