CacheBy
Atlas Antibodies Anti-CYP20A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CYP20A1 Antibody

상품 한눈에 보기

Human CYP20A1 단백질을 타깃으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형 항체로 IHC 및 ICC 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 유사성 확인. 실험 조건은 사용자 최적화 필요.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055872-100 Anti-CYP20A1 Antibody, cytochrome P450, family 20, subfamily A, polypeptide 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055872-25 Anti-CYP20A1 Antibody, cytochrome P450, family 20, subfamily A, polypeptide 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CYP20A1 Antibody

Anti-CYP20A1 Antibody

Target: cytochrome P450, family 20, subfamily A, polypeptide 1
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human CYP20A1.

Alternative Gene Names

  • CYP-M

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein cytochrome P450, family 20, subfamily A, polypeptide 1
Target Gene CYP20A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (95%), Rat (93%)

Antigen Sequence:
PGITPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTLDPFETMLKSL

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.