Atlas Antibodies Anti-CYB5R2 Antibody

상품 한눈에 보기

Human CYB5R2 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot 및 Immunocytochemistry에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 반응하며 Rat, Mouse와도 유사성이 있습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA061707-100 Anti-CYB5R2 Antibody, cytochrome b5 reductase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA061707-25 Anti-CYB5R2 Antibody, cytochrome b5 reductase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CYB5R2 Antibody

Anti-CYB5R2 Antibody

Overview

Polyclonal antibody against Human cytochrome b5 reductase 2 (CYB5R2)

Recommended Applications

Western Blot (WB)
Immunocytochemistry (ICC)

Product Description

This polyclonal antibody targets Human CYB5R2 and is affinity purified using the PrEST antigen as an affinity ligand.

Open Datasheet (PDF)

Target Information

항목	내용
Target Protein	cytochrome b5 reductase 2
Target Gene	CYB5R2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000019751 (73%), Mouse ENSMUSG00000048065 (71%)

Antigen Sequence:
MTQYLENMKIGETIFFRGPRGRLFYHGPGNLGIRPDQTSEPKKTLADHLGMI

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide (preservative)
MSDS	Material Safety Data Sheet