Atlas Antibodies Anti-CYB5B Antibody

상품 한눈에 보기

인간 CYB5B 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 보장. 정제된 글리세롤/PBS 완충액 형태로 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA007893-100 Anti-CYB5B Antibody, cytochrome b5 type B (outer mitochondrial membrane) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA007893-25 Anti-CYB5B Antibody, cytochrome b5 type B (outer mitochondrial membrane) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cytochrome b5 type B (outer mitochondrial membrane)
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

Polyclonal antibody against Human CYB5B.

항목	내용
Target Protein	cytochrome b5 type B (outer mitochondrial membrane)
Target Gene	CYB5B
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	EVETSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLLEQAGVDASESFEDVGHSSDAREMLKQYYIGDIHPSDLKPESGSKD
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000031924 (82%), Rat ENSRNOG00000011142 (79%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)