CacheBy
Atlas Antibodies Anti-CXorf67 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CXorf67 Antibody

상품 한눈에 보기

인간 CXorf67 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 독립 및 직교 검증을 통해 단백질 발현 신뢰성 향상. 토끼 유래 IgG 항체로 PrEST 항원으로 친화 정제됨.

카탈로그번호
HPA006128-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006128-100 Anti-CXorf67 Antibody, chromosome X open reading frame 67 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006128-25 Anti-CXorf67 Antibody, chromosome X open reading frame 67 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CXorf67 Antibody

Anti-CXorf67 Antibody

Target: chromosome X open reading frame 67 (CXorf67)
Type: Polyclonal Antibody against Human CXorf67


  • IHC (Independent Validation)
    Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Orthogonal Validation)
    Orthogonal validation of protein expression using Western blot by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC (Immunocytochemistry)
    Suitable for immunocytochemistry applications.


Product Description

Polyclonal antibody generated in rabbit against human CXorf67 using recombinant PrEST antigen.

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein chromosome X open reading frame 67
Target Gene CXorf67
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat: 27% (ENSRNOG00000033202), Mouse: 26% (ENSMUSG00000093908)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TVSSQASPSGGAALSSSTAGSSAAAATSAAIFITDEASGLPIIAAVLTERHSDRQDCRSPHEVFGCVVPEGGSQAAVGPQKATGHADEHLAQTKSPGNSRRRKQPCRNQAAPAQKPPGRRLFPEPLPPSSPGFRPSSYPCSGAST

Additional Information

Material Safety Data Sheet (Sodium Azide)


제품 이미지

Enhanced Validation
IHC Independent Validation
WB Orthogonal Validation
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.