CacheBy
Atlas Antibodies Anti-CXorf56 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CXorf56 Antibody

상품 한눈에 보기

인간 CXorf56 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC 및 WB(재조합 발현 검증)에 적합하며, PrEST 항원으로 친화 정제되었습니다. 40% 글리세롤 기반 완충액에 보존제가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038245-100 Anti-CXorf56 Antibody, chromosome X open reading frame 56 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038245-25 Anti-CXorf56 Antibody, chromosome X open reading frame 56 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CXorf56 Antibody

Anti-CXorf56 Antibody

Target: Chromosome X open reading frame 56 (CXorf56)
Type: Polyclonal Antibody against Human CXorf56

  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody raised in rabbit against human CXorf56 protein.

Alternative Gene Names

  • FLJ22965

Open Datasheet

Target Information

항목 내용
Target Protein Chromosome X open reading frame 56
Target Gene CXorf56
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVIDAAKHAHKFCNTEDE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012564 (100%)
  • Mouse ENSMUSG00000006423 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.