CacheBy
Atlas Antibodies Anti-CXCR2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CXCR2 Antibody

상품 한눈에 보기

Human CXCR2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. RNA-seq 데이터 기반 단백질 발현 비교로 신뢰성 향상. Affinity 정제된 고품질 항체로 다양한 연구 응용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031999-100 Anti-CXCR2 Antibody, chemokine (C-X-C motif) receptor 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031999-25 Anti-CXCR2 Antibody, chemokine (C-X-C motif) receptor 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CXCR2 Antibody

Anti-CXCR2 Antibody

Target: chemokine (C-X-C motif) receptor 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CXCR2


Alternative Gene Names

CD182, CMKAR2, IL8RB

Open Datasheet


Target Information

항목 내용
Target Protein chemokine (C-X-C motif) receptor 2
Target Gene CXCR2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence DFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000026180 (46%), Rat ENSRNOG00000014269 (43%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.