CacheBy
Atlas Antibodies Anti-CUTA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CUTA Antibody

상품 한눈에 보기

인간 CUTA 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 반응성이 검증되었고, 마우스 및 랫트와 높은 서열 유사성을 가짐. 실험 전 부드럽게 혼합 필요.

카탈로그번호
HPA064369-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064369-100 Anti-CUTA Antibody, cutA divalent cation tolerance homolog (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064369-25 Anti-CUTA Antibody, cutA divalent cation tolerance homolog (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CUTA Antibody

Anti-CUTA Antibody

Target: cutA divalent cation tolerance homolog (E. coli)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human CUTA.


Alternative Gene Names

ACHAP, C6orf82

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cutA divalent cation tolerance homolog (E. coli)
Target Gene CUTA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000024194 (91%), Rat ENSRNOG00000000481 (89%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.