CacheBy
Atlas Antibodies Anti-CTNNBL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTNNBL1 Antibody

상품 한눈에 보기

Human CTNNBL1 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit 유래 IgG 형식입니다. WB 및 ICC 응용에 권장되며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되어 신뢰성 높은 단백질 분석에 적합합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027906-100 Anti-CTNNBL1 Antibody, catenin beta like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027906-25 Anti-CTNNBL1 Antibody, catenin beta like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTNNBL1 Antibody

Anti-CTNNBL1 Antibody

Target Protein: catenin beta like 1
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human CTNNBL1


Alternative Gene Names

C20orf33, FLJ21108, NAP, NYD-SP19, P14, P14L

Open Datasheet


Antigen Information

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000012021 95%
Mouse ENSMUSG00000027649 94%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Recommended Application
ICC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.