Atlas Antibodies Anti-CTNNA1 Antibody

상품 한눈에 보기

Human CTNNA1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. Human, Mouse, Rat 간 교차 반응 확인됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA063535-100 Anti-CTNNA1 Antibody, catenin (cadherin-associated protein), alpha 1, 102kDa 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA063535-25 Anti-CTNNA1 Antibody, catenin (cadherin-associated protein), alpha 1, 102kDa 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: catenin (cadherin-associated protein), alpha 1, 102kDa
Target Gene: CTNNA1
Alternative Gene Names: CAP102

Polyclonal antibody against Human CTNNA1.

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.