CacheBy
Atlas Antibodies Anti-CTH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTH Antibody

상품 한눈에 보기

Human CTH 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 가짐. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021591-100 Anti-CTH Antibody, cystathionine gamma-lyase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021591-25 Anti-CTH Antibody, cystathionine gamma-lyase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTH Antibody

Anti-CTH Antibody

Target: cystathionine gamma-lyase (CTH)
Type: Polyclonal Antibody against Human CTH
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody raised in rabbit against human cystathionine gamma-lyase (CTH).
Validated for immunohistochemistry (IHC) with orthogonal RNA-seq comparison.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein cystathionine gamma-lyase
Target Gene CTH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD
Verified Species Reactivity Human
Interspecies Homology Mouse (87%), Rat (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.