Atlas Antibodies Anti-CTDSP1 Antibody

상품 한눈에 보기

인간 CTDSP1 단백질을 인식하는 고품질 폴리클로날 항체입니다. Rabbit 유래 IgG 형식으로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, 인간에서 검증된 반응성을 제공합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062654-100 Anti-CTDSP1 Antibody, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062654-25 Anti-CTDSP1 Antibody, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CTDSP1 Antibody

Anti-CTDSP1 Antibody

CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1

Recommended Applications

면역세포화학 (ICC)

Product Description

Polyclonal Antibody against Human CTDSP1

Alternative Gene Names

NLIIF
SCP1

Open Datasheet

Target Information

항목	내용
Target Protein	CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1
Target Gene	CTDSP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Identity
Mouse	ENSMUSG00000026176	95%
Rat	ENSRNOG00000015295	93%

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand