CacheBy
Atlas Antibodies Anti-CSTF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CSTF1 Antibody

상품 한눈에 보기

Human CSTF1 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원으로 정제되었으며 높은 종간 반응성을 보입니다. 40% glycerol/PBS buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065000-100 Anti-CSTF1 Antibody, cleavage stimulation factor, 3` pre-RNA, subunit 1, 50kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065000-25 Anti-CSTF1 Antibody, cleavage stimulation factor, 3` pre-RNA, subunit 1, 50kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CSTF1 Antibody

Anti-CSTF1 Antibody

Target: cleavage stimulation factor, 3' pre-RNA, subunit 1 (50 kDa)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human CSTF1.

Open Datasheet

Target Information

항목 내용
Target Protein cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
Target Gene CSTF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000027498 (100%), Rat ENSRNOG00000004775 (100%)

Antigen Sequence

TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Storage Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.