Atlas Antibodies Anti-CSTB Antibody

상품 한눈에 보기

Human CSTB 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 기반 Orthogonal 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA017380-100 Anti-CSTB Antibody, cystatin B (stefin B) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA017380-25 Anti-CSTB Antibody, cystatin B (stefin B) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cystatin B (stefin B)
Type: Polyclonal Antibody against Human CSTB

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against human CSTB (cystatin B, stefin B).

CST6, EPM1, PME, STFB

항목	내용
Target Protein	cystatin B (stefin B)
Target Gene	CSTB
Antigen Sequence	QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000005054 (76%), Rat ENSRNOG00000001201 (76%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet