CacheBy
Atlas Antibodies Anti-CST3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CST3 Antibody

상품 한눈에 보기

인간 CST3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 토끼 IgG 항체이며, 고순도의 PrEST 항원을 이용해 친화정제되었습니다. RNA-seq 데이터 기반 정교한 단백질 발현 검증이 수행되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013143-100 Anti-CST3 Antibody, cystatin C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013143-25 Anti-CST3 Antibody, cystatin C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CST3 Antibody

Anti-CST3 Antibody

Target Protein: cystatin C
Supplier: Atlas Antibodies


  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB (Orthogonal Validation)
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.

  • ICC


Product Description

Polyclonal Antibody against Human CST3
Open Datasheet (PDF)


Antigen Information

  • Target Gene: CST3
  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    SSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000005195 73%
Mouse ENSMUSG00000027447 72%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.