Atlas Antibodies Anti-CSRNP2 Antibody

상품 한눈에 보기

Human CSRNP2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. 재조합 발현 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019914-100 Anti-CSRNP2 Antibody, cysteine-serine-rich nuclear protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019914-25 Anti-CSRNP2 Antibody, cysteine-serine-rich nuclear protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cysteine-serine-rich nuclear protein 2 (CSRNP2)
Supplier: Atlas Antibodies

Recombinant expression validation:
Validation in WB using target protein overexpression.

Polyclonal antibody against human CSRNP2.

C12ORF2, C12orf22, FAM130A1, PPP1R72, TAIP-12

항목	내용
Target Protein	cysteine-serine-rich nuclear protein 2
Target Gene	CSRNP2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000044636 (87%), Rat ENSRNOG00000019653 (87%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.