CacheBy
Atlas Antibodies Anti-CSF2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CSF2 Antibody

상품 한눈에 보기

인간 CSF2(GM-CSF)를 인식하는 토끼 폴리클로날 항체로, 면역세포 자극 인자 연구에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용 가능. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

카탈로그번호
HPA062006-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062006-100 Anti-CSF2 Antibody, colony stimulating factor 2 (granulocyte-macrophage) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062006-25 Anti-CSF2 Antibody, colony stimulating factor 2 (granulocyte-macrophage) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CSF2 Antibody

Anti-CSF2 Antibody

Target Information

  • Target Protein: Colony stimulating factor 2 (granulocyte-macrophage)
  • Target Gene: CSF2
  • Alternative Gene Names: GM-CSF, GMCSF

Product Description

Polyclonal antibody against human CSF2 (GM-CSF), suitable for research applications involving granulocyte-macrophage colony stimulating factor.

  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    STQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000026805 (59%)
  • Mouse ENSMUSG00000018916 (50%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.