CacheBy
Atlas Antibodies Anti-ROS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ROS1 Antibody

상품 한눈에 보기

인간 ROS1 단백질을 인식하는 토끼 유래 폴리클로날 항체입니다. 면역조직화학(IHC) 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 동일성을 보입니다. 안정적인 PBS/glycerol 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049098-100 Anti-ROS1 Antibody, ROS proto-oncogene 1 , receptor tyrosine kinase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049098-25 Anti-ROS1 Antibody, ROS proto-oncogene 1 , receptor tyrosine kinase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ROS1 Antibody

Anti-ROS1 Antibody

Target: ROS proto-oncogene 1, receptor tyrosine kinase
Supplier: Atlas Antibodies

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human ROS1.

Alternative Gene Names

  • c-ros-1
  • MCF3
  • ROS

Open Datasheet

Target Information

항목 내용
Target Protein ROS proto-oncogene 1, receptor tyrosine kinase
Target Gene ROS1
Verified Species Reactivity Human
Interspecies Identity Mouse 90%, Rat 87%

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WKYNEFYHVKTSCSQGPAYVCNITNLQPYTSYNVRVVVVYKTGENSTSLPESFKTKAGVPNKPGIPKLLEGSKNSIQWEKAEDNGC

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.