CacheBy
Atlas Antibodies Anti-ROPN1L Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ROPN1L Antibody

상품 한눈에 보기

Human ROPN1L 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 기반 단백질 발현 분석에 적합합니다. Orthogonal 검증을 통해 RNA-seq 데이터와 비교된 신뢰성 높은 결과를 제공합니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041830-100 Anti-ROPN1L Antibody, rhophilin associated tail protein 1-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041830-25 Anti-ROPN1L Antibody, rhophilin associated tail protein 1-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ROPN1L Antibody

Anti-ROPN1L Antibody

Target: rhophilin associated tail protein 1-like (ROPN1L)
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human ROPN1L.


Alternative Gene Names

ASP, FLJ25776, RSPH11

Open Datasheet


Specifications

항목 내용
Target Protein rhophilin associated tail protein 1-like
Target Gene ROPN1L
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022236 (48%), Rat ENSRNOG00000042781 (47%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.