CacheBy
Atlas Antibodies Anti-RNF40 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RNF40 Antibody

상품 한눈에 보기

Human RNF40 단백질을 인식하는 폴리클로날 항체로, IHC와 WB에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human, Mouse, Rat에 반응하며, RNF40 관련 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054227-100 Anti-RNF40 Antibody, ring finger protein 40, E3 ubiquitin protein ligase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054227-25 Anti-RNF40 Antibody, ring finger protein 40, E3 ubiquitin protein ligase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RNF40 Antibody

Anti-RNF40 Antibody

Target: ring finger protein 40 (E3 ubiquitin protein ligase)
Type: Polyclonal Antibody against Human RNF40


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody targeting human RNF40, an E3 ubiquitin-protein ligase involved in histone modification and gene regulation.


Alternative Gene Names

BRE1B, KIAA0661, RBP95, STARING

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence:

AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME

Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000018840 (91%)
  • Mouse ENSMUSG00000030816 (90%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Storage Store at -20°C; avoid repeated freeze-thaw cycles
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.