Atlas Antibodies Anti-RNF213 Antibody

상품 한눈에 보기

Human RNF213 단백질에 특이적인 polyclonal antibody로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Orthogonal validation으로 단백질 발현 검증 완료. 40% 글리세롤 기반 버퍼에 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026790-100 Anti-RNF213 Antibody, ring finger protein 213 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026790-25 Anti-RNF213 Antibody, ring finger protein 213 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RNF213 Antibody

Anti-RNF213 Antibody

Target Protein: ring finger protein 213 (RNF213)
Product Type: Polyclonal Antibody against Human RNF213
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human RNF213 using a recombinant PrEST antigen.

Alternative Gene Names

C17orf27, KIAA1554, KIAA1618, MYMY2, NET57

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VGKNEQGEPEDLKKPEGKNRSAAAVKNEKEQKNQEADVQEVKASTLSPGGGVTVFFHAIISLHFPFNPDLHKVFIRGGEEFGESKWDSNICELHYTRDLGHDRVLVEGIVCISKKHLDKYIPYKYVIYNGESFEYEFIYKH

Verified Species Reactivity

Human

Interspecies Information

Species	Ortholog ID	Sequence Identity
Rat	ENSRNOG00000029658	48%
Mouse	ENSMUSG00000070327	47%

Specification

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Storage	Store at -20°C
Handling Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.